Anti KY pAb (ATL-HPA036492)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036492-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KY
Alternative Gene Name: FLJ33207
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035606: 71%, ENSRNOG00000008210: 69%
Entrez Gene ID: 339855
Uniprot ID: Q8NBH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ |
| Gene Sequence | AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ |
| Gene ID - Mouse | ENSMUSG00000035606 |
| Gene ID - Rat | ENSRNOG00000008210 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KY pAb (ATL-HPA036492) | |
| Datasheet | Anti KY pAb (ATL-HPA036492) Datasheet (External Link) |
| Vendor Page | Anti KY pAb (ATL-HPA036492) at Atlas Antibodies |
| Documents & Links for Anti KY pAb (ATL-HPA036492) | |
| Datasheet | Anti KY pAb (ATL-HPA036492) Datasheet (External Link) |
| Vendor Page | Anti KY pAb (ATL-HPA036492) |