Anti KY pAb (ATL-HPA036492)

Atlas Antibodies

Catalog No.:
ATL-HPA036492-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kyphoscoliosis peptidase
Gene Name: KY
Alternative Gene Name: FLJ33207
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035606: 71%, ENSRNOG00000008210: 69%
Entrez Gene ID: 339855
Uniprot ID: Q8NBH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ
Gene Sequence AQGTLSDQQANPSSLLQRGGGFQGVGNGVRRWQKLEGNDFHENLVEKQHPQQPQVITSYNSQGTQLTVEVHPRDAMPQ
Gene ID - Mouse ENSMUSG00000035606
Gene ID - Rat ENSRNOG00000008210
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KY pAb (ATL-HPA036492)
Datasheet Anti KY pAb (ATL-HPA036492) Datasheet (External Link)
Vendor Page Anti KY pAb (ATL-HPA036492) at Atlas Antibodies

Documents & Links for Anti KY pAb (ATL-HPA036492)
Datasheet Anti KY pAb (ATL-HPA036492) Datasheet (External Link)
Vendor Page Anti KY pAb (ATL-HPA036492)