Anti KTN1 pAb (ATL-HPA017876 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA017876-25

Protein Description: kinectin 1 (kinesin receptor)
Gene Name: KTN1
Alternative Gene Name: CG1, KIAA0004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021843: 62%, ENSRNOG00000012255: 57%
Entrez Gene ID: 3895
Uniprot ID: Q86UP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE
• Gene Sequence: ELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQLKQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNERQQQVEAVELEAKE
• Gene ID - Mouse: ENSMUSG00000021843
• Gene ID - Rat: ENSRNOG00000012255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.