Anti KRT84 pAb (ATL-HPA039714)

Atlas Antibodies

Catalog No.:
ATL-HPA039714-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: keratin 84, type II
Gene Name: KRT84
Alternative Gene Name: Hb-4, KRTHB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044294: 61%, ENSRNOG00000008819: 62%
Entrez Gene ID: 3890
Uniprot ID: Q9NSB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV
Gene Sequence CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV
Gene ID - Mouse ENSMUSG00000044294
Gene ID - Rat ENSRNOG00000008819
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT84 pAb (ATL-HPA039714)
Datasheet Anti KRT84 pAb (ATL-HPA039714) Datasheet (External Link)
Vendor Page Anti KRT84 pAb (ATL-HPA039714) at Atlas Antibodies

Documents & Links for Anti KRT84 pAb (ATL-HPA039714)
Datasheet Anti KRT84 pAb (ATL-HPA039714) Datasheet (External Link)
Vendor Page Anti KRT84 pAb (ATL-HPA039714)