Anti KPTN pAb (ATL-HPA041796)

Atlas Antibodies

Catalog No.: ATL-HPA041796-25

Protein Description: kaptin (actin binding protein)
Gene Name: KPTN
Alternative Gene Name: 2E4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006021: 87%, ENSRNOG00000001493: 88%
Entrez Gene ID: 11133
Uniprot ID: Q9Y664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL
• Gene Sequence: FLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL
• Gene ID - Mouse: ENSMUSG00000006021
• Gene ID - Rat: ENSRNOG00000001493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.