Anti KPTN pAb (ATL-HPA041796)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041796-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KPTN
Alternative Gene Name: 2E4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006021: 87%, ENSRNOG00000001493: 88%
Entrez Gene ID: 11133
Uniprot ID: Q9Y664
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL |
| Gene Sequence | FLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVL |
| Gene ID - Mouse | ENSMUSG00000006021 |
| Gene ID - Rat | ENSRNOG00000001493 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KPTN pAb (ATL-HPA041796) | |
| Datasheet | Anti KPTN pAb (ATL-HPA041796) Datasheet (External Link) |
| Vendor Page | Anti KPTN pAb (ATL-HPA041796) at Atlas Antibodies |
| Documents & Links for Anti KPTN pAb (ATL-HPA041796) | |
| Datasheet | Anti KPTN pAb (ATL-HPA041796) Datasheet (External Link) |
| Vendor Page | Anti KPTN pAb (ATL-HPA041796) |