Anti KNSTRN pAb (ATL-HPA042027)

Atlas Antibodies

Catalog No.: ATL-HPA042027-25

Protein Description: kinetochore-localized astrin/SPAG5 binding protein
Gene Name: KNSTRN
Alternative Gene Name: C15orf23, FLJ14502, kinastrin, SKAP, TRAF4AF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027331: 66%, ENSRNOG00000009334: 64%
Entrez Gene ID: 90417
Uniprot ID: Q9Y448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
• Gene Sequence: TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ
• Gene ID - Mouse: ENSMUSG00000027331
• Gene ID - Rat: ENSRNOG00000009334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KNSTRN pAb (ATL-HPA042027) – 7 Found

Chung, Hee Jin; Park, Ji Eun; Lee, Nam Soo; Kim, Hongtae; Jang, Chang-Young. Phosphorylation of Astrin Regulates Its Kinetochore Function. The Journal Of Biological Chemistry. 2016;291(34):17579-92. 

Shrestha, Roshan L; Conti, Duccio; Tamura, Naoka; Braun, Dominique; Ramalingam, Revathy A; Cieslinski, Konstanty; Ries, Jonas; Draviam, Viji M. Aurora-B kinase pathway controls the lateral to end-on conversion of kinetochore-microtubule attachments in human cells. Nature Communications. 2017;8(1):150. 

Song, Xinhong; Conti, Duccio; Shrestha, Roshan L; Braun, Dominique; Draviam, Viji M. Counteraction between Astrin-PP1 and Cyclin-B-CDK1 pathways protects chromosome-microtubule attachments independent of biorientation. Nature Communications. 2021;12(1):7010. 

Ferrandiz, Nuria; Downie, Laura; Starling, Georgina P; Royle, Stephen J. Endomembranes promote chromosome missegregation by ensheathing misaligned chromosomes. The Journal Of Cell Biology. 2022;221(6) 

Shrestha, Roshan L; Draviam, Viji M. Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK. Current Biology : Cb. 2013;23(16):1514-26. 

Tamura, Naoka; Simon, Judith E; Nayak, Arnab; Shenoy, Rajesh T; Hiroi, Noriko; Boilot, Viviane; Funahashi, Akira; Draviam, Viji M. A proteomic study of mitotic phase-specific interactors of EB1 reveals a role for SXIP-mediated protein interactions in anaphase onset. Biology Open. 2015;4(2):155-69. 

Conti, Duccio; Gul, Parveen; Islam, Asifa; Martín-Durán, José M; Pickersgill, Richard W; Draviam, Viji M. Kinetochores attached to microtubule-ends are stabilised by Astrin bound PP1 to ensure proper chromosome segregation. Elife. 2019;8( 31808746)