Anti KIT pAb (ATL-HPA004471)

Atlas Antibodies

Catalog No.:
ATL-HPA004471-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 66%, ENSRNOG00000002227: 72%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Gene Sequence VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Gene ID - Mouse ENSMUSG00000005672
Gene ID - Rat ENSRNOG00000002227
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIT pAb (ATL-HPA004471)
Datasheet Anti KIT pAb (ATL-HPA004471) Datasheet (External Link)
Vendor Page Anti KIT pAb (ATL-HPA004471) at Atlas Antibodies

Documents & Links for Anti KIT pAb (ATL-HPA004471)
Datasheet Anti KIT pAb (ATL-HPA004471) Datasheet (External Link)
Vendor Page Anti KIT pAb (ATL-HPA004471)
Citations for Anti KIT pAb (ATL-HPA004471) – 3 Found
Mudd, Joseph C; Busman-Sahay, Kathleen; DiNapoli, Sarah R; Lai, Stephen; Sheik, Virginia; Lisco, Andrea; Deleage, Claire; Richardson, Brian; Palesch, David J; Paiardini, Mirko; Cameron, Mark; Sereti, Irini; Reeves, R Keith; Estes, Jacob D; Brenchley, Jason M. Hallmarks of primate lentiviral immunodeficiency infection recapitulate loss of innate lymphoid cells. Nature Communications. 2018;9(1):3967.  PubMed
Wang, Quan; Shen, Yilin; Ye, Bin; Hu, Haixia; Fan, Cui; Wang, Tan; Zheng, Yuqin; Lv, Jingrong; Ma, Yan; Xiang, Mingliang. Gene expression differences between thyroid carcinoma, thyroid adenoma and normal thyroid tissue. Oncology Reports. 2018;40(6):3359-3369.  PubMed
Webb, Gabriela M; Molden, Jhomary; Busman-Sahay, Kathleen; Abdulhaqq, Shaheed; Wu, Helen L; Weber, Whitney C; Bateman, Katherine B; Reed, Jason S; Northrup, Mina; Maier, Nicholas; Tanaka, Shiho; Gao, Lina; Davey, Brianna; Carpenter, Benjamin L; Axthelm, Michael K; Stanton, Jeffrey J; Smedley, Jeremy; Greene, Justin M; Safrit, Jeffrey T; Estes, Jacob D; Skinner, Pamela J; Sacha, Jonah B. The human IL-15 superagonist N-803 promotes migration of virus-specific CD8+ T and NK cells to B cell follicles but does not reverse latency in ART-suppressed, SHIV-infected macaques. Plos Pathogens. 2020;16(3):e1008339.  PubMed