Anti KIT pAb (ATL-HPA004471)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004471-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 66%, ENSRNOG00000002227: 72%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ |
| Gene Sequence | VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ |
| Gene ID - Mouse | ENSMUSG00000005672 |
| Gene ID - Rat | ENSRNOG00000002227 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIT pAb (ATL-HPA004471) | |
| Datasheet | Anti KIT pAb (ATL-HPA004471) Datasheet (External Link) |
| Vendor Page | Anti KIT pAb (ATL-HPA004471) at Atlas Antibodies |
| Documents & Links for Anti KIT pAb (ATL-HPA004471) | |
| Datasheet | Anti KIT pAb (ATL-HPA004471) Datasheet (External Link) |
| Vendor Page | Anti KIT pAb (ATL-HPA004471) |
| Citations for Anti KIT pAb (ATL-HPA004471) – 3 Found |
| Mudd, Joseph C; Busman-Sahay, Kathleen; DiNapoli, Sarah R; Lai, Stephen; Sheik, Virginia; Lisco, Andrea; Deleage, Claire; Richardson, Brian; Palesch, David J; Paiardini, Mirko; Cameron, Mark; Sereti, Irini; Reeves, R Keith; Estes, Jacob D; Brenchley, Jason M. Hallmarks of primate lentiviral immunodeficiency infection recapitulate loss of innate lymphoid cells. Nature Communications. 2018;9(1):3967. PubMed |
| Wang, Quan; Shen, Yilin; Ye, Bin; Hu, Haixia; Fan, Cui; Wang, Tan; Zheng, Yuqin; Lv, Jingrong; Ma, Yan; Xiang, Mingliang. Gene expression differences between thyroid carcinoma, thyroid adenoma and normal thyroid tissue. Oncology Reports. 2018;40(6):3359-3369. PubMed |
| Webb, Gabriela M; Molden, Jhomary; Busman-Sahay, Kathleen; Abdulhaqq, Shaheed; Wu, Helen L; Weber, Whitney C; Bateman, Katherine B; Reed, Jason S; Northrup, Mina; Maier, Nicholas; Tanaka, Shiho; Gao, Lina; Davey, Brianna; Carpenter, Benjamin L; Axthelm, Michael K; Stanton, Jeffrey J; Smedley, Jeremy; Greene, Justin M; Safrit, Jeffrey T; Estes, Jacob D; Skinner, Pamela J; Sacha, Jonah B. The human IL-15 superagonist N-803 promotes migration of virus-specific CD8+ T and NK cells to B cell follicles but does not reverse latency in ART-suppressed, SHIV-infected macaques. Plos Pathogens. 2020;16(3):e1008339. PubMed |