Anti KIF9 pAb (ATL-HPA022033)

Atlas Antibodies

Catalog No.:
ATL-HPA022033-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: kinesin family member 9
Gene Name: KIF9
Alternative Gene Name: MGC104186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032489: 90%, ENSRNOG00000020891: 91%
Entrez Gene ID: 64147
Uniprot ID: Q9HAQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTG
Gene Sequence KVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTG
Gene ID - Mouse ENSMUSG00000032489
Gene ID - Rat ENSRNOG00000020891
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF9 pAb (ATL-HPA022033)
Datasheet Anti KIF9 pAb (ATL-HPA022033) Datasheet (External Link)
Vendor Page Anti KIF9 pAb (ATL-HPA022033) at Atlas Antibodies

Documents & Links for Anti KIF9 pAb (ATL-HPA022033)
Datasheet Anti KIF9 pAb (ATL-HPA022033) Datasheet (External Link)
Vendor Page Anti KIF9 pAb (ATL-HPA022033)
Citations for Anti KIF9 pAb (ATL-HPA022033) – 2 Found
Miyata, Haruhiko; Shimada, Keisuke; Morohoshi, Akane; Oura, Seiya; Matsumura, Takafumi; Xu, Zoulan; Oyama, Yuki; Ikawa, Masahito. Testis-enriched kinesin KIF9 is important for progressive motility in mouse spermatozoa. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2020;34(4):5389-5400.  PubMed
Cho, Jung Hoon; Li, Zipeng A; Zhu, Lifei; Muegge, Brian D; Roseman, Henry F; Lee, Eun Young; Utterback, Toby; Woodhams, Louis G; Bayly, Philip V; Hughes, Jing W. Islet primary cilia motility controls insulin secretion. Science Advances. 2022;8(38):eabq8486.  PubMed