Anti KIF9 pAb (ATL-HPA022031)

Atlas Antibodies

Catalog No.: ATL-HPA022031-100

Protein Description: kinesin family member 9
Gene Name: KIF9
Alternative Gene Name: MGC104186
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032489: 83%, ENSRNOG00000020891: 87%
Entrez Gene ID: 64147
Uniprot ID: Q9HAQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKI
• Gene Sequence: YCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKI
• Gene ID - Mouse: ENSMUSG00000032489
• Gene ID - Rat: ENSRNOG00000020891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.