Anti KIF15 pAb (ATL-HPA035517)

Atlas Antibodies

Catalog No.: ATL-HPA035517-25

Protein Description: kinesin family member 15
Gene Name: KIF15
Alternative Gene Name: HKLP2, KNSL7, NY-BR-62
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036768: 74%, ENSRNOG00000060356: 70%
Entrez Gene ID: 56992
Uniprot ID: Q9NS87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD
• Gene Sequence: ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILD
• Gene ID - Mouse: ENSMUSG00000036768
• Gene ID - Rat: ENSRNOG00000060356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIF15 pAb (ATL-HPA035517) – 2 Found

Engqvist, Hanna; Parris, Toshima Z; Kovács, Anikó; Rönnerman, Elisabeth Werner; Sundfeldt, Karin; Karlsson, Per; Helou, Khalil. Validation of Novel Prognostic Biomarkers for Early-Stage Clear-Cell, Endometrioid and Mucinous Ovarian Carcinomas Using Immunohistochemistry. Frontiers In Oncology. 10( 32133296):162. 

Sun, Xinwei; Chen, Mengyue; Liao, Bin; Liang, Zhiqing. Knockdown of KIF15 promotes cell apoptosis by activating crosstalk of multiple pathways in ovarian cancer: bioinformatic and experimental analysis. International Journal Of Clinical And Experimental Pathology. 14(2):267-291.