Anti KIF14 pAb (ATL-HPA038061)

Atlas Antibodies

Catalog No.:
ATL-HPA038061-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kinesin family member 14
Gene Name: KIF14
Alternative Gene Name: KIAA0042
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041498: 30%, ENSRNOG00000037211: 34%
Entrez Gene ID: 9928
Uniprot ID: Q15058
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVV
Gene Sequence KESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVV
Gene ID - Mouse ENSMUSG00000041498
Gene ID - Rat ENSRNOG00000037211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIF14 pAb (ATL-HPA038061)
Datasheet Anti KIF14 pAb (ATL-HPA038061) Datasheet (External Link)
Vendor Page Anti KIF14 pAb (ATL-HPA038061) at Atlas Antibodies

Documents & Links for Anti KIF14 pAb (ATL-HPA038061)
Datasheet Anti KIF14 pAb (ATL-HPA038061) Datasheet (External Link)
Vendor Page Anti KIF14 pAb (ATL-HPA038061)
Citations for Anti KIF14 pAb (ATL-HPA038061) – 3 Found
Gerashchenko, Tatiana S; Zolotaryova, Sofia Y; Kiselev, Artem M; Tashireva, Liubov A; Novikov, Nikita M; Krakhmal, Nadezhda V; Cherdyntseva, Nadezhda V; Zavyalova, Marina V; Perelmuter, Vladimir M; Denisov, Evgeny V. The Activity of KIF14, Mieap, and EZR in a New Type of the Invasive Component, Torpedo-Like Structures, Predetermines the Metastatic Potential of Breast Cancer. Cancers. 2020;12(7)  PubMed
Neska-Długosz, Izabela; Buchholz, Karolina; Durślewicz, Justyna; Gagat, Maciej; Grzanka, Dariusz; Tojek, Krzysztof; Klimaszewska-Wiśniewska, Anna. Prognostic Impact and Functional Annotations of KIF11 and KIF14 Expression in Patients with Colorectal Cancer. International Journal Of Molecular Sciences. 2021;22(18)  PubMed
Klimaszewska-Wiśniewska, Anna; Neska-Długosz, Izabela; Buchholz, Karolina; Durślewicz, Justyna; Grzanka, Dariusz; Kasperska, Anna; Antosik, Paulina; Zabrzyński, Jan; Grzanka, Alina; Gagat, Maciej. Prognostic Significance of KIF11 and KIF14 Expression in Pancreatic Adenocarcinoma. Cancers. 2021;13(12)  PubMed