Anti KIF14 pAb (ATL-HPA038061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038061-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: KIF14
Alternative Gene Name: KIAA0042
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041498: 30%, ENSRNOG00000037211: 34%
Entrez Gene ID: 9928
Uniprot ID: Q15058
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVV |
| Gene Sequence | KESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVV |
| Gene ID - Mouse | ENSMUSG00000041498 |
| Gene ID - Rat | ENSRNOG00000037211 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIF14 pAb (ATL-HPA038061) | |
| Datasheet | Anti KIF14 pAb (ATL-HPA038061) Datasheet (External Link) |
| Vendor Page | Anti KIF14 pAb (ATL-HPA038061) at Atlas Antibodies |
| Documents & Links for Anti KIF14 pAb (ATL-HPA038061) | |
| Datasheet | Anti KIF14 pAb (ATL-HPA038061) Datasheet (External Link) |
| Vendor Page | Anti KIF14 pAb (ATL-HPA038061) |
| Citations for Anti KIF14 pAb (ATL-HPA038061) – 3 Found |
| Gerashchenko, Tatiana S; Zolotaryova, Sofia Y; Kiselev, Artem M; Tashireva, Liubov A; Novikov, Nikita M; Krakhmal, Nadezhda V; Cherdyntseva, Nadezhda V; Zavyalova, Marina V; Perelmuter, Vladimir M; Denisov, Evgeny V. The Activity of KIF14, Mieap, and EZR in a New Type of the Invasive Component, Torpedo-Like Structures, Predetermines the Metastatic Potential of Breast Cancer. Cancers. 2020;12(7) PubMed |
| Neska-Długosz, Izabela; Buchholz, Karolina; Durślewicz, Justyna; Gagat, Maciej; Grzanka, Dariusz; Tojek, Krzysztof; Klimaszewska-Wiśniewska, Anna. Prognostic Impact and Functional Annotations of KIF11 and KIF14 Expression in Patients with Colorectal Cancer. International Journal Of Molecular Sciences. 2021;22(18) PubMed |
| Klimaszewska-Wiśniewska, Anna; Neska-Długosz, Izabela; Buchholz, Karolina; Durślewicz, Justyna; Grzanka, Dariusz; Kasperska, Anna; Antosik, Paulina; Zabrzyński, Jan; Grzanka, Alina; Gagat, Maciej. Prognostic Significance of KIF11 and KIF14 Expression in Pancreatic Adenocarcinoma. Cancers. 2021;13(12) PubMed |