Anti KIAA1429 pAb (ATL-HPA031530)

Atlas Antibodies

Catalog No.: ATL-HPA031530-25

Protein Description: KIAA1429
Gene Name: KIAA1429
Alternative Gene Name: DKFZP434I116, fSAP121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040720: 100%, ENSRNOG00000014664: 100%
Entrez Gene ID: 25962
Uniprot ID: Q69YN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL
• Gene Sequence: LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVALNTRKL
• Gene ID - Mouse: ENSMUSG00000040720
• Gene ID - Rat: ENSRNOG00000014664
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIAA1429 pAb (ATL-HPA031530) – 2 Found

Zhang, Huijuan; Hu, Jing; Liu, Aina; Qu, Huajun; Jiang, Fenge; Wang, Congcong; Mo, Steven; Sun, Ping. An N6-Methyladenosine-Related Gene Set Variation Score as a Prognostic Tool for Lung Adenocarcinoma. Frontiers In Cell And Developmental Biology. 9( 34307344):651575. 

Condic, Mateja; Thiesler, Thore; Staerk, Christian; Klümper, Niklas; Ellinger, Jörg; Egger, Eva K; Kübler, Kirsten; Kristiansen, Glen; Mustea, Alexander; Ralser, Damian J. N6-methyladenosine RNA modification (m6A) is of prognostic value in HPV-dependent vulvar squamous cell carcinoma. Bmc Cancer. 2022;22(1):943.