Anti KIAA1211 pAb (ATL-HPA043249)

Atlas Antibodies

Catalog No.: ATL-HPA043249-25

Protein Description: KIAA1211
Gene Name: KIAA1211
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036377: 61%, ENSRNOG00000002139: 53%
Entrez Gene ID: 57482
Uniprot ID: Q6ZU35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEKREEGDTEPLLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQVSSGGKQILFPKVNLSPVTPAKDTGLTAAPQEPKAPKASPVQ
• Gene Sequence: EEKREEGDTEPLLKQEGPVEAAQPPVERKEAAALEQGRKVEELRWQEVDERQTMPRPYTFQVSSGGKQILFPKVNLSPVTPAKDTGLTAAPQEPKAPKASPVQ
• Gene ID - Mouse: ENSMUSG00000036377
• Gene ID - Rat: ENSRNOG00000002139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KIAA1211 pAb (ATL-HPA043249) – 1 Found

Cui, Anfang; Xue, Yuchan; Wang, Xi'ao; Huang, Yanhong; Han, Xiaolin; Li, Xiangling; Niu, Delei; Niu, Shaorui; Zhao, Yujie; Yang, Xinyu; Yu, Wei. Knockdown of CRAD suppresses the growth and promotes the apoptosis of human lung cancer cells via Claudin 4. Bioscience Reports. 2020;40(10)