Anti KIAA0895 pAb (ATL-HPA021036)

Atlas Antibodies

Catalog No.:
ATL-HPA021036-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KIAA0895
Gene Name: KIAA0895
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036411: 59%, ENSRNOG00000026979: 60%
Entrez Gene ID: 23366
Uniprot ID: Q8NCT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQIVVHLTEDLLSRASMTVVNGCPTLTINVSTAR
Gene Sequence AIKPTNLEKEKLRFFKSDYTYNPQFEYANPALPSVLAKHSHASDRFLKQIVVHLTEDLLSRASMTVVNGCPTLTINVSTAR
Gene ID - Mouse ENSMUSG00000036411
Gene ID - Rat ENSRNOG00000026979
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA0895 pAb (ATL-HPA021036)
Datasheet Anti KIAA0895 pAb (ATL-HPA021036) Datasheet (External Link)
Vendor Page Anti KIAA0895 pAb (ATL-HPA021036) at Atlas Antibodies

Documents & Links for Anti KIAA0895 pAb (ATL-HPA021036)
Datasheet Anti KIAA0895 pAb (ATL-HPA021036) Datasheet (External Link)
Vendor Page Anti KIAA0895 pAb (ATL-HPA021036)