Anti KIAA0100 pAb (ATL-HPA042781)

Atlas Antibodies

Catalog No.:
ATL-HPA042781-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: KIAA0100
Gene Name: KIAA0100
Alternative Gene Name: BCOX, BCOX1, CT101, DKFZp686M0843, MGC111488
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010277: 98%, ENSRNOG00000011887: 98%
Entrez Gene ID: 9703
Uniprot ID: Q14667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN
Gene Sequence EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN
Gene ID - Mouse ENSMUSG00000010277
Gene ID - Rat ENSRNOG00000011887
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KIAA0100 pAb (ATL-HPA042781)
Datasheet Anti KIAA0100 pAb (ATL-HPA042781) Datasheet (External Link)
Vendor Page Anti KIAA0100 pAb (ATL-HPA042781) at Atlas Antibodies

Documents & Links for Anti KIAA0100 pAb (ATL-HPA042781)
Datasheet Anti KIAA0100 pAb (ATL-HPA042781) Datasheet (External Link)
Vendor Page Anti KIAA0100 pAb (ATL-HPA042781)