Anti KHDRBS3 pAb (ATL-HPA000500)

Atlas Antibodies

Catalog No.: ATL-HPA000500-25

Protein Description: KH domain containing, RNA binding, signal transduction associated 3
Gene Name: KHDRBS3
Alternative Gene Name: Etle, etoile, SALP, SLM-2, SLM2, T-STAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022332: 99%, ENSRNOG00000009539: 99%
Entrez Gene ID: 10656
Uniprot ID: O75525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARM
• Gene Sequence: GEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARM
• Gene ID - Mouse: ENSMUSG00000022332
• Gene ID - Rat: ENSRNOG00000009539
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KHDRBS3 pAb (ATL-HPA000500) – 2 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Sernbo, Sandra; Borrebaeck, Carl A K; Uhlén, Mathias; Jirström, Karin; Ek, Sara. Nuclear T-STAR protein expression correlates with HER2 status, hormone receptor negativity and prolonged recurrence free survival in primary breast cancer and decreased cancer cell growth in vitro. Plos One. 8(7):e70596.