Anti KERA pAb (ATL-HPA039321)

Atlas Antibodies

Catalog No.: ATL-HPA039321-25

Protein Description: keratocan
Gene Name: KERA
Alternative Gene Name: CNA2, SLRR2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019932: 77%, ENSRNOG00000004635: 77%
Entrez Gene ID: 11081
Uniprot ID: O60938
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL
• Gene Sequence: SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL
• Gene ID - Mouse: ENSMUSG00000019932
• Gene ID - Rat: ENSRNOG00000004635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KERA pAb (ATL-HPA039321) – 3 Found

Syed-Picard, Fatima N; Du, Yiqin; Lathrop, Kira L; Mann, Mary M; Funderburgh, Martha L; Funderburgh, James L. Dental pulp stem cells: a new cellular resource for corneal stromal regeneration. Stem Cells Translational Medicine. 2015;4(3):276-85. 

Syed-Picard, Fatima N; Du, Yiqin; Hertsenberg, Andrew J; Palchesko, Rachelle; Funderburgh, Martha L; Feinberg, Adam W; Funderburgh, James L. Scaffold-free tissue engineering of functional corneal stromal tissue. Journal Of Tissue Engineering And Regenerative Medicine. 2018;12(1):59-69. 

Fernández-Pérez, Julia; Madden, Peter W; Ahearne, Mark. Engineering a Corneal Stromal Equivalent Using a Novel Multilayered Fabrication Assembly Technique. Tissue Engineering. Part A. 2020;26(19-20):1030-1041.