Anti KCTD21 pAb (ATL-HPA041964)

Atlas Antibodies

Catalog No.:
ATL-HPA041964-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium channel tetramerization domain containing 21
Gene Name: KCTD21
Alternative Gene Name: KCASH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044952: 99%, ENSRNOG00000024793: 97%
Entrez Gene ID: 283219
Uniprot ID: Q4G0X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPN
Gene Sequence EKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPN
Gene ID - Mouse ENSMUSG00000044952
Gene ID - Rat ENSRNOG00000024793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCTD21 pAb (ATL-HPA041964)
Datasheet Anti KCTD21 pAb (ATL-HPA041964) Datasheet (External Link)
Vendor Page Anti KCTD21 pAb (ATL-HPA041964) at Atlas Antibodies

Documents & Links for Anti KCTD21 pAb (ATL-HPA041964)
Datasheet Anti KCTD21 pAb (ATL-HPA041964) Datasheet (External Link)
Vendor Page Anti KCTD21 pAb (ATL-HPA041964)