Anti KCTD20 pAb (ATL-HPA030092)

Atlas Antibodies

Catalog No.: ATL-HPA030092-25

Protein Description: potassium channel tetramerization domain containing 20
Gene Name: KCTD20
Alternative Gene Name: C6orf69, dJ108K11.3, MGC14254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005936: 86%, ENSRNOG00000000517: 76%
Entrez Gene ID: 222658
Uniprot ID: Q7Z5Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
• Gene Sequence: LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
• Gene ID - Mouse: ENSMUSG00000005936
• Gene ID - Rat: ENSRNOG00000000517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.