Anti KCNMB3 pAb (ATL-HPA019185)

Atlas Antibodies

Catalog No.:
ATL-HPA019185-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: potassium large conductance calcium-activated channel, subfamily M beta member 3
Gene Name: KCNMB3
Alternative Gene Name: KCNMB2, KCNMBL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091091: 31%, ENSRNOG00000009932: 31%
Entrez Gene ID: 27094
Uniprot ID: Q9NPA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS
Gene Sequence RLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLCIMRRSKGRAEKS
Gene ID - Mouse ENSMUSG00000091091
Gene ID - Rat ENSRNOG00000009932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNMB3 pAb (ATL-HPA019185)
Datasheet Anti KCNMB3 pAb (ATL-HPA019185) Datasheet (External Link)
Vendor Page Anti KCNMB3 pAb (ATL-HPA019185) at Atlas Antibodies

Documents & Links for Anti KCNMB3 pAb (ATL-HPA019185)
Datasheet Anti KCNMB3 pAb (ATL-HPA019185) Datasheet (External Link)
Vendor Page Anti KCNMB3 pAb (ATL-HPA019185)