Anti KCNK10 pAb (ATL-HPA030462)

Atlas Antibodies

Catalog No.:
ATL-HPA030462-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: potassium channel, subfamily K, member 10
Gene Name: KCNK10
Alternative Gene Name: K2p10.1, PPP1R97, TREK-2, TREK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033854: 97%, ENSRNOG00000003813: 98%
Entrez Gene ID: 54207
Uniprot ID: P57789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA
Gene Sequence RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA
Gene ID - Mouse ENSMUSG00000033854
Gene ID - Rat ENSRNOG00000003813
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KCNK10 pAb (ATL-HPA030462)
Datasheet Anti KCNK10 pAb (ATL-HPA030462) Datasheet (External Link)
Vendor Page Anti KCNK10 pAb (ATL-HPA030462) at Atlas Antibodies

Documents & Links for Anti KCNK10 pAb (ATL-HPA030462)
Datasheet Anti KCNK10 pAb (ATL-HPA030462) Datasheet (External Link)
Vendor Page Anti KCNK10 pAb (ATL-HPA030462)