Anti KCNK10 pAb (ATL-HPA030462)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030462-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KCNK10
Alternative Gene Name: K2p10.1, PPP1R97, TREK-2, TREK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033854: 97%, ENSRNOG00000003813: 98%
Entrez Gene ID: 54207
Uniprot ID: P57789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA |
| Gene Sequence | RSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTA |
| Gene ID - Mouse | ENSMUSG00000033854 |
| Gene ID - Rat | ENSRNOG00000003813 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNK10 pAb (ATL-HPA030462) | |
| Datasheet | Anti KCNK10 pAb (ATL-HPA030462) Datasheet (External Link) |
| Vendor Page | Anti KCNK10 pAb (ATL-HPA030462) at Atlas Antibodies |
| Documents & Links for Anti KCNK10 pAb (ATL-HPA030462) | |
| Datasheet | Anti KCNK10 pAb (ATL-HPA030462) Datasheet (External Link) |
| Vendor Page | Anti KCNK10 pAb (ATL-HPA030462) |