Anti KCNIP1 pAb (ATL-HPA022864)

Atlas Antibodies

Catalog No.: ATL-HPA022864-100

Protein Description: Kv channel interacting protein 1
Gene Name: KCNIP1
Alternative Gene Name: KCHIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053519: 100%, ENSRNOG00000005365: 69%
Entrez Gene ID: 30820
Uniprot ID: Q9NZI2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
• Gene Sequence: AVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY
• Gene ID - Mouse: ENSMUSG00000053519
• Gene ID - Rat: ENSRNOG00000005365
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.