Anti KCND2 pAb (ATL-HPA029068)

Atlas Antibodies

Catalog No.: ATL-HPA029068-25

Protein Description: potassium voltage-gated channel, Shal-related subfamily, member 2
Gene Name: KCND2
Alternative Gene Name: KIAA1044, Kv4.2, RK5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060882: 99%, ENSRNOG00000014686: 49%
Entrez Gene ID: 3751
Uniprot ID: Q9NZV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSA
• Gene Sequence: GSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSA
• Gene ID - Mouse: ENSMUSG00000060882
• Gene ID - Rat: ENSRNOG00000014686
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KCND2 pAb (ATL-HPA029068) – 3 Found

Chang, Anne L S; Atzmon, Gil; Bergman, Aviv; Brugmann, Samantha; Atwood, Scott X; Chang, Howard Y; Barzilai, Nir. Identification of genes promoting skin youthfulness by genome-wide association study. The Journal Of Investigative Dermatology. 2014;134(3):651-657. 

Hu, Jia-Hua; Malloy, Cole; Tabor, G Travis; Gutzmann, Jakob J; Liu, Ying; Abebe, Daniel; Karlsson, Rose-Marie; Durell, Stewart; Cameron, Heather A; Hoffman, Dax A. Activity-dependent isomerization of Kv4.2 by Pin1 regulates cognitive flexibility. Nature Communications. 2020;11(1):1567. 

Hu, Jia-Hua; Liu, Ying; Hoffman, Dax A. Identification of Kv4.2 protein complex and modifications by tandem affinity purification-mass spectrometry in primary neurons. Frontiers In Cellular Neuroscience. 16( 36568885):1070305.