Anti KBTBD8 pAb (ATL-HPA041285)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041285-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: KBTBD8
Alternative Gene Name: KIAA1842, TA-KRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030031: 93%, ENSRNOG00000013390: 95%
Entrez Gene ID: 84541
Uniprot ID: Q8NFY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV |
| Gene Sequence | IRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTV |
| Gene ID - Mouse | ENSMUSG00000030031 |
| Gene ID - Rat | ENSRNOG00000013390 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KBTBD8 pAb (ATL-HPA041285) | |
| Datasheet | Anti KBTBD8 pAb (ATL-HPA041285) Datasheet (External Link) |
| Vendor Page | Anti KBTBD8 pAb (ATL-HPA041285) at Atlas Antibodies |
| Documents & Links for Anti KBTBD8 pAb (ATL-HPA041285) | |
| Datasheet | Anti KBTBD8 pAb (ATL-HPA041285) Datasheet (External Link) |
| Vendor Page | Anti KBTBD8 pAb (ATL-HPA041285) |