Anti KATNB1 pAb (ATL-HPA041165 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041165-25

Protein Description: katanin p80 (WD repeat containing) subunit B 1
Gene Name: KATNB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031787: 88%, ENSRNOG00000014626: 90%
Entrez Gene ID: 10300
Uniprot ID: Q9BVA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVV
• Gene Sequence: SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVV
• Gene ID - Mouse: ENSMUSG00000031787
• Gene ID - Rat: ENSRNOG00000014626
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KATNB1 pAb (ATL-HPA041165 w/enhanced validation) – 2 Found

Dunleavy, Jessica E M; Okuda, Hidenobu; O'Connor, Anne E; Merriner, D Jo; O'Donnell, Liza; Jamsai, Duangporn; Bergmann, Martin; O'Bryan, Moira K. Katanin-like 2 (KATNAL2) functions in multiple aspects of haploid male germ cell development in the mouse. Plos Genetics. 2017;13(11):e1007078. 

O'Donnell, Liza; Rhodes, Danielle; Smith, Stephanie J; Merriner, D Jo; Clark, Brett J; Borg, Claire; Whittle, Belinda; O'Connor, Anne E; Smith, Lee B; McNally, Francis J; de Kretser, David M; Goodnow, Chris C; Ormandy, Chris J; Jamsai, Duangporn; O'Bryan, Moira K. An essential role for katanin p80 and microtubule severing in male gamete production. Plos Genetics. 8(5):e1002698.