Anti JMY pAb (ATL-HPA043308)

Atlas Antibodies

Catalog No.: ATL-HPA043308-25

Protein Description: junction mediating and regulatory protein, p53 cofactor
Gene Name: JMY
Alternative Gene Name: FLJ37870
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021690: 91%, ENSRNOG00000050343: 87%
Entrez Gene ID: 133746
Uniprot ID: Q8N9B5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF
• Gene Sequence: VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF
• Gene ID - Mouse: ENSMUSG00000021690
• Gene ID - Rat: ENSRNOG00000050343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.