Anti JAM3 pAb (ATL-HPA003417)

Atlas Antibodies

Catalog No.: ATL-HPA003417-25

Protein Description: junctional adhesion molecule 3
Gene Name: JAM3
Alternative Gene Name: JAM-C, JAMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031990: 87%, ENSRNOG00000009149: 85%
Entrez Gene ID: 83700
Uniprot ID: Q9BX67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
• Gene Sequence: RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
• Gene ID - Mouse: ENSMUSG00000031990
• Gene ID - Rat: ENSRNOG00000009149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti JAM3 pAb (ATL-HPA003417) – 2 Found

Higashi, Yusuke; Sukhanov, Sergiy; Shai, Shaw-Yung; Danchuk, Svitlana; Snarski, Patricia; Li, Zhaohui; Hou, Xuwei; Hamblin, Milton H; Woods, T Cooper; Wang, Meifang; Wang, Derek; Yu, Hong; Korthuis, Ronald J; Yoshida, Tadashi; Delafontaine, Patrice. Endothelial deficiency of insulin-like growth factor-1 receptor reduces endothelial barrier function and promotes atherosclerosis in Apoe-deficient mice. American Journal Of Physiology. Heart And Circulatory Physiology. 2020;319(4):H730-H743. 

Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38.