Anti ITPKB pAb (ATL-HPA030273 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA030273-25

Protein Description: inositol-trisphosphate 3-kinase B
Gene Name: ITPKB
Alternative Gene Name: IP3-3KB, IP3KB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038855: 83%, ENSRNOG00000002969: 82%
Entrez Gene ID: 3707
Uniprot ID: P27987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE
• Gene Sequence: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE
• Gene ID - Mouse: ENSMUSG00000038855
• Gene ID - Rat: ENSRNOG00000002969
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.