Anti ITPKA pAb (ATL-HPA040454)

Atlas Antibodies

Catalog No.: ATL-HPA040454-25

Protein Description: inositol-trisphosphate 3-kinase A
Gene Name: ITPKA
Alternative Gene Name: IP3-3KA, IP3KA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027296: 91%, ENSRNOG00000005284: 89%
Entrez Gene ID: 3706
Uniprot ID: P23677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
• Gene Sequence: DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSEFFRRHEV
• Gene ID - Mouse: ENSMUSG00000027296
• Gene ID - Rat: ENSRNOG00000005284
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITPKA pAb (ATL-HPA040454) – 1 Found

Shaosheng, Wang; Shaochuang, Wang; Lichun, Fan; Na, Xie; Xiaohong, Zhao. ITPKA induces cell senescence, inhibits ovarian cancer tumorigenesis and can be downregulated by miR-203. Aging. 2021;13(8):11822-11832.