Anti ITIH1 pAb (ATL-HPA042049)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042049-25
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/91797/167372/atl-hpa042049_anti-itih1-pab-atl-hpa042049_49019__04113.1681120389.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)")
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ITIH1
Alternative Gene Name: H1P, IATIH, ITIH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006529: 73%, ENSRNOG00000033386: 73%
Entrez Gene ID: 3697
Uniprot ID: P19827
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK |
| Gene Sequence | PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK |
| Gene ID - Mouse | ENSMUSG00000006529 |
| Gene ID - Rat | ENSRNOG00000033386 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ITIH1 pAb (ATL-HPA042049) | |
| Datasheet | Anti ITIH1 pAb (ATL-HPA042049) Datasheet (External Link) |
| Vendor Page | Anti ITIH1 pAb (ATL-HPA042049) at Atlas Antibodies |
| Documents & Links for Anti ITIH1 pAb (ATL-HPA042049) | |
| Datasheet | Anti ITIH1 pAb (ATL-HPA042049) Datasheet (External Link) |
| Vendor Page | Anti ITIH1 pAb (ATL-HPA042049) |
| Citations for Anti ITIH1 pAb (ATL-HPA042049) – 2 Found |
| Chou, C-H; Attarian, D E; Wisniewski, H-G; Band, P A; Kraus, V B. TSG-6 - a double-edged sword for osteoarthritis (OA). Osteoarthritis And Cartilage. 2018;26(2):245-254. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |