Anti ISYNA1 pAb (ATL-HPA007931 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007931-25

Protein Description: inositol-3-phosphate synthase 1
Gene Name: ISYNA1
Alternative Gene Name: Ino1, INOS, IPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019139: 93%, ENSRNOG00000019741: 95%
Entrez Gene ID: 51477
Uniprot ID: Q9NPH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA
• Gene Sequence: SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDLA
• Gene ID - Mouse: ENSMUSG00000019139
• Gene ID - Rat: ENSRNOG00000019741
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.