Anti ISM2 pAb (ATL-HPA039742)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039742-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ISM2
Alternative Gene Name: FLJ32147, TAIL1, THSD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050671: 51%, ENSRNOG00000050312: 53%
Entrez Gene ID: 145501
Uniprot ID: Q6H9L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQE |
| Gene Sequence | QVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLSWLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQE |
| Gene ID - Mouse | ENSMUSG00000050671 |
| Gene ID - Rat | ENSRNOG00000050312 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ISM2 pAb (ATL-HPA039742) | |
| Datasheet | Anti ISM2 pAb (ATL-HPA039742) Datasheet (External Link) |
| Vendor Page | Anti ISM2 pAb (ATL-HPA039742) at Atlas Antibodies |
| Documents & Links for Anti ISM2 pAb (ATL-HPA039742) | |
| Datasheet | Anti ISM2 pAb (ATL-HPA039742) Datasheet (External Link) |
| Vendor Page | Anti ISM2 pAb (ATL-HPA039742) |