Anti ISM2 pAb (ATL-HPA039314)

Atlas Antibodies

Catalog No.: ATL-HPA039314-25

Protein Description: isthmin 2
Gene Name: ISM2
Alternative Gene Name: FLJ32147, TAIL1, THSD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050671: 57%, ENSRNOG00000050312: 53%
Entrez Gene ID: 145501
Uniprot ID: Q6H9L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQ
• Gene Sequence: LREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRTQEVTPLLLELQKLPELVHATLSTPNPDNQ
• Gene ID - Mouse: ENSMUSG00000050671
• Gene ID - Rat: ENSRNOG00000050312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.