Anti IRX1 pAb (ATL-HPA043160)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043160-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: IRX1
Alternative Gene Name: IRX-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060969: 86%, ENSRNOG00000033609: 85%
Entrez Gene ID: 79192
Uniprot ID: P78414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS |
| Gene Sequence | NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS |
| Gene ID - Mouse | ENSMUSG00000060969 |
| Gene ID - Rat | ENSRNOG00000033609 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IRX1 pAb (ATL-HPA043160) | |
| Datasheet | Anti IRX1 pAb (ATL-HPA043160) Datasheet (External Link) |
| Vendor Page | Anti IRX1 pAb (ATL-HPA043160) at Atlas Antibodies |
| Documents & Links for Anti IRX1 pAb (ATL-HPA043160) | |
| Datasheet | Anti IRX1 pAb (ATL-HPA043160) Datasheet (External Link) |
| Vendor Page | Anti IRX1 pAb (ATL-HPA043160) |
| Citations for Anti IRX1 pAb (ATL-HPA043160) – 2 Found |
| Yu, Wenjie; Li, Xiao; Eliason, Steven; Romero-Bustillos, Miguel; Ries, Ryan J; Cao, Huojun; Amendt, Brad A. Irx1 regulates dental outer enamel epithelial and lung alveolar type II epithelial differentiation. Developmental Biology. 2017;429(1):44-55. PubMed |
| Yu, Wenjie; Sun, Zhao; Sweat, Yan; Sweat, Mason; Venugopalan, Shankar Rengasamy; Eliason, Steven; Cao, Huojun; Paine, Michael L; Amendt, Brad A. Pitx2-Sox2-Lef1 interactions specify progenitor oral/dental epithelial cell signaling centers. Development (Cambridge, England). 2020;147(11) PubMed |