Anti IRX1 pAb (ATL-HPA043160)

Atlas Antibodies

Catalog No.:
ATL-HPA043160-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: iroquois homeobox 1
Gene Name: IRX1
Alternative Gene Name: IRX-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060969: 86%, ENSRNOG00000033609: 85%
Entrez Gene ID: 79192
Uniprot ID: P78414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS
Gene Sequence NKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS
Gene ID - Mouse ENSMUSG00000060969
Gene ID - Rat ENSRNOG00000033609
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IRX1 pAb (ATL-HPA043160)
Datasheet Anti IRX1 pAb (ATL-HPA043160) Datasheet (External Link)
Vendor Page Anti IRX1 pAb (ATL-HPA043160) at Atlas Antibodies

Documents & Links for Anti IRX1 pAb (ATL-HPA043160)
Datasheet Anti IRX1 pAb (ATL-HPA043160) Datasheet (External Link)
Vendor Page Anti IRX1 pAb (ATL-HPA043160)
Citations for Anti IRX1 pAb (ATL-HPA043160) – 2 Found
Yu, Wenjie; Li, Xiao; Eliason, Steven; Romero-Bustillos, Miguel; Ries, Ryan J; Cao, Huojun; Amendt, Brad A. Irx1 regulates dental outer enamel epithelial and lung alveolar type II epithelial differentiation. Developmental Biology. 2017;429(1):44-55.  PubMed
Yu, Wenjie; Sun, Zhao; Sweat, Yan; Sweat, Mason; Venugopalan, Shankar Rengasamy; Eliason, Steven; Cao, Huojun; Paine, Michael L; Amendt, Brad A. Pitx2-Sox2-Lef1 interactions specify progenitor oral/dental epithelial cell signaling centers. Development (Cambridge, England). 2020;147(11)  PubMed