Anti IREB2 pAb (ATL-HPA040371)

Atlas Antibodies

Catalog No.: ATL-HPA040371-25

Protein Description: iron-responsive element binding protein 2
Gene Name: IREB2
Alternative Gene Name: IRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032293: 97%, ENSRNOG00000013271: 98%
Entrez Gene ID: 3658
Uniprot ID: P48200
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLK
• Gene Sequence: LTVDHSLQIDFSKCAIQNAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPEPETVLK
• Gene ID - Mouse: ENSMUSG00000032293
• Gene ID - Rat: ENSRNOG00000013271
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.