Anti IQGAP2 pAb (ATL-HPA037404)

Atlas Antibodies

Catalog No.:
ATL-HPA037404-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: IQ motif containing GTPase activating protein 2
Gene Name: IQGAP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021676: 67%, ENSRNOG00000025406: 64%
Entrez Gene ID: 10788
Uniprot ID: Q13576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDS
Gene Sequence DANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDS
Gene ID - Mouse ENSMUSG00000021676
Gene ID - Rat ENSRNOG00000025406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IQGAP2 pAb (ATL-HPA037404)
Datasheet Anti IQGAP2 pAb (ATL-HPA037404) Datasheet (External Link)
Vendor Page Anti IQGAP2 pAb (ATL-HPA037404) at Atlas Antibodies

Documents & Links for Anti IQGAP2 pAb (ATL-HPA037404)
Datasheet Anti IQGAP2 pAb (ATL-HPA037404) Datasheet (External Link)
Vendor Page Anti IQGAP2 pAb (ATL-HPA037404)