Anti IQGAP2 pAb (ATL-HPA037403)

Atlas Antibodies

Catalog No.: ATL-HPA037403-25

Protein Description: IQ motif containing GTPase activating protein 2
Gene Name: IQGAP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021676: 77%, ENSRNOG00000025406: 77%
Entrez Gene ID: 10788
Uniprot ID: Q13576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIGLNNLDKAYVERYANTLLSVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGN
• Gene Sequence: AIGLNNLDKAYVERYANTLLSVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGN
• Gene ID - Mouse: ENSMUSG00000021676
• Gene ID - Rat: ENSRNOG00000025406
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.