Anti IQCB1 pAb (ATL-HPA042028)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042028-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IQCB1
Alternative Gene Name: KIAA0036, NPHP5, SLSN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022837: 86%, ENSRNOG00000038868: 88%
Entrez Gene ID: 9657
Uniprot ID: Q15051
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMK |
| Gene Sequence | AVTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMK |
| Gene ID - Mouse | ENSMUSG00000022837 |
| Gene ID - Rat | ENSRNOG00000038868 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IQCB1 pAb (ATL-HPA042028) | |
| Datasheet | Anti IQCB1 pAb (ATL-HPA042028) Datasheet (External Link) |
| Vendor Page | Anti IQCB1 pAb (ATL-HPA042028) at Atlas Antibodies |
| Documents & Links for Anti IQCB1 pAb (ATL-HPA042028) | |
| Datasheet | Anti IQCB1 pAb (ATL-HPA042028) Datasheet (External Link) |
| Vendor Page | Anti IQCB1 pAb (ATL-HPA042028) |