Anti IQCB1 pAb (ATL-HPA042028)

Atlas Antibodies

Catalog No.:
ATL-HPA042028-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: IQ motif containing B1
Gene Name: IQCB1
Alternative Gene Name: KIAA0036, NPHP5, SLSN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022837: 86%, ENSRNOG00000038868: 88%
Entrez Gene ID: 9657
Uniprot ID: Q15051
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMK
Gene Sequence AVTLQRAALKFLAKCRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERLQHYFMGRALEERAQQHREALIAQISTNVEQLMK
Gene ID - Mouse ENSMUSG00000022837
Gene ID - Rat ENSRNOG00000038868
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IQCB1 pAb (ATL-HPA042028)
Datasheet Anti IQCB1 pAb (ATL-HPA042028) Datasheet (External Link)
Vendor Page Anti IQCB1 pAb (ATL-HPA042028) at Atlas Antibodies

Documents & Links for Anti IQCB1 pAb (ATL-HPA042028)
Datasheet Anti IQCB1 pAb (ATL-HPA042028) Datasheet (External Link)
Vendor Page Anti IQCB1 pAb (ATL-HPA042028)