Anti IPMK pAb (ATL-HPA037837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037837-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: IPMK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060733: 92%, ENSRNOG00000000609: 90%
Entrez Gene ID: 253430
Uniprot ID: Q8NFU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD |
| Gene Sequence | DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD |
| Gene ID - Mouse | ENSMUSG00000060733 |
| Gene ID - Rat | ENSRNOG00000000609 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti IPMK pAb (ATL-HPA037837) | |
| Datasheet | Anti IPMK pAb (ATL-HPA037837) Datasheet (External Link) |
| Vendor Page | Anti IPMK pAb (ATL-HPA037837) at Atlas Antibodies |
| Documents & Links for Anti IPMK pAb (ATL-HPA037837) | |
| Datasheet | Anti IPMK pAb (ATL-HPA037837) Datasheet (External Link) |
| Vendor Page | Anti IPMK pAb (ATL-HPA037837) |