Anti IP6K2 pAb (ATL-HPA007532)

Atlas Antibodies

Catalog No.: ATL-HPA007532-25

Protein Description: inositol hexakisphosphate kinase 2
Gene Name: IP6K2
Alternative Gene Name: IHPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106672: 94%, ENSRNOG00000020361: 94%
Entrez Gene ID: 51447
Uniprot ID: Q9UHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP
• Gene Sequence: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTP
• Gene ID - Mouse: ENSMUSG00000106672
• Gene ID - Rat: ENSRNOG00000020361
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IP6K2 pAb (ATL-HPA007532) – 2 Found

Fu, Chenglai; Rojas, Tomas; Chin, Alfred C; Cheng, Weiwei; Bernstein, Isaac A; Albacarys, Lauren K; Wright, William W; Snyder, Solomon H. Multiple aspects of male germ cell development and interactions with Sertoli cells require inositol hexakisphosphate kinase-1. Scientific Reports. 2018;8(1):7039. 

Sandström, Josefine; Balian, Alien; Lockowandt, Rebecca; Fornander, Tommy; Nordenskjöld, Bo; Lindström, Linda; Pérez-Tenorio, Gizeh; Stål, Olle. IP6K2 predicts favorable clinical outcome of primary breast cancer. Molecular And Clinical Oncology. 2021;14(5):94.