Anti INTS4 pAb (ATL-HPA042378)

Atlas Antibodies

Catalog No.: ATL-HPA042378-25

Protein Description: integrator complex subunit 4
Gene Name: INTS4
Alternative Gene Name: INT4, MGC16733, MST093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025133: 98%, ENSRNOG00000012552: 97%
Entrez Gene ID: 92105
Uniprot ID: Q96HW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCI
• Gene Sequence: RVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFARKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCI
• Gene ID - Mouse: ENSMUSG00000025133
• Gene ID - Rat: ENSRNOG00000012552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.