Anti INTS11 pAb (ATL-HPA029025)

Atlas Antibodies

Catalog No.: ATL-HPA029025-25

Protein Description: integrator complex subunit 11
Gene Name: INTS11
Alternative Gene Name: CPSF3L, CPSF73L, FLJ20542, INT11, RC-68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029034: 96%, ENSRNOG00000019712: 95%
Entrez Gene ID: 54973
Uniprot ID: Q5TA45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALK
• Gene Sequence: LVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALK
• Gene ID - Mouse: ENSMUSG00000029034
• Gene ID - Rat: ENSRNOG00000019712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INTS11 pAb (ATL-HPA029025) – 5 Found

Yue, Jingyin; Lai, Fan; Beckedorff, Felipe; Zhang, Anda; Pastori, Chiara; Shiekhattar, Ramin. Integrator orchestrates RAS/ERK1/2 signaling transcriptional programs. Genes & Development. 2017;31(17):1809-1820. 

Dasilva, Lucas Ferreira; Blumenthal, Ezra; Beckedorff, Felipe; Cingaram, Pradeep Reddy; Gomes Dos Santos, Helena; Edupuganti, Raghu Ram; Zhang, Anda; Dokaneheifard, Sadat; Aoi, Yuki; Yue, Jingyin; Kirstein, Nina; Tayari, Mina Masoumeh; Shilatifard, Ali; Shiekhattar, Ramin. Integrator enforces the fidelity of transcriptional termination at protein-coding genes. Science Advances. 2021;7(45):eabe3393. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Levy, Shiri; Allerston, Charles K; Liveanu, Varda; Habib, Mouna R; Gileadi, Opher; Schuster, Gadi. Identification of LACTB2, a metallo-β-lactamase protein, as a human mitochondrial endoribonuclease. Nucleic Acids Research. 2016;44(4):1813-32. 

Barra, Jasmine; Gaidosh, Gabriel S; Blumenthal, Ezra; Beckedorff, Felipe; Tayari, Mina M; Kirstein, Nina; Karakach, Tobias K; Jensen, Torben Heick; Impens, Francis; Gevaert, Kris; Leucci, Eleonora; Shiekhattar, Ramin; Marine, Jean-Christophe. Integrator restrains paraspeckles assembly by promoting isoform switching of the lncRNA NEAT1. Science Advances. 2020;6(27):eaaz9072.