Anti INTS11 pAb (ATL-HPA028379)

Atlas Antibodies

Catalog No.: ATL-HPA028379-25

Protein Description: integrator complex subunit 11
Gene Name: INTS11
Alternative Gene Name: CPSF3L, CPSF73L, FLJ20542, INT11, RC-68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029034: 92%, ENSRNOG00000019712: 92%
Entrez Gene ID: 54973
Uniprot ID: Q5TA45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG
• Gene Sequence: LGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLTSLLKKG
• Gene ID - Mouse: ENSMUSG00000029034
• Gene ID - Rat: ENSRNOG00000019712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INTS11 pAb (ATL-HPA028379) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.