Anti INSL3 pAb (ATL-HPA028615 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028615-25

Protein Description: insulin-like 3 (Leydig cell)
Gene Name: INSL3
Alternative Gene Name: MGC119818, MGC119819, RLF, RLNL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079019: 63%, ENSRNOG00000018757: 63%
Entrez Gene ID: 3640
Uniprot ID: P51460
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
• Gene Sequence: EMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY
• Gene ID - Mouse: ENSMUSG00000079019
• Gene ID - Rat: ENSRNOG00000018757
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti INSL3 pAb (ATL-HPA028615 w/enhanced validation) – 3 Found

Masterson, John M; Bui, Chau; Zhang, Yi; Yuan, Xiaopen; Huynh, Carissa; Jawanda, Harneet; Hasan, Wohaib; Tourtellotte, Warren; Luthringer, Daniel; Garcia, Maurice M. Feminising hormone therapy reduces testicular ACE-2 receptor expression: Implications for treatment or prevention of COVID-19 infection in men. Andrologia. 2021;53(11):e14186. 

Hauptman, Dinko; Perić, Marta Himelreich; Marić, Tihana; Bojanac, Ana Katušić; Sinčić, Nino; Zimak, Zoran; Kaštelan, Željko; Ježek, Davor. Leydig Cells in Patients with Non-Obstructive Azoospermia: Do They Really Proliferate?. Life (Basel, Switzerland). 2021;11(11) 

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.