Anti INSC pAb (ATL-HPA039769)

Atlas Antibodies

Catalog No.:
ATL-HPA039769-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: inscuteable homolog (Drosophila)
Gene Name: INSC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048782: 95%, ENSRNOG00000024712: 97%
Entrez Gene ID: 387755
Uniprot ID: Q1MX18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLY
Gene Sequence CLQVENEHVLKSMKACVSETLSMLGQHFGQLLELALTREVQALVRKIDASDNIYTTESTTGNLFSLTQEGAPLCRIIAKEGGVVALFKVCRQDSFRCLY
Gene ID - Mouse ENSMUSG00000048782
Gene ID - Rat ENSRNOG00000024712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INSC pAb (ATL-HPA039769)
Datasheet Anti INSC pAb (ATL-HPA039769) Datasheet (External Link)
Vendor Page Anti INSC pAb (ATL-HPA039769) at Atlas Antibodies

Documents & Links for Anti INSC pAb (ATL-HPA039769)
Datasheet Anti INSC pAb (ATL-HPA039769) Datasheet (External Link)
Vendor Page Anti INSC pAb (ATL-HPA039769)