Anti INO80E pAb (ATL-HPA043146)

Atlas Antibodies

Catalog No.: ATL-HPA043146-25

Protein Description: INO80 complex subunit E
Gene Name: INO80E
Alternative Gene Name: CCDC95, FLJ90652
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030689: 89%, ENSRNOG00000019960: 90%
Entrez Gene ID: 283899
Uniprot ID: Q8NBZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
• Gene Sequence: LPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDD
• Gene ID - Mouse: ENSMUSG00000030689
• Gene ID - Rat: ENSRNOG00000019960
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.