Anti IL1RN pAb (ATL-HPA001482 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001482-25

Protein Description: interleukin 1 receptor antagonist
Gene Name: IL1RN
Alternative Gene Name: ICIL-1RA, IL-1RN, IL1F3, IL1RA, IRAP, MGC10430
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026981: 76%, ENSRNOG00000005871: 73%
Entrez Gene ID: 3557
Uniprot ID: P18510
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF
• Gene Sequence: ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF
• Gene ID - Mouse: ENSMUSG00000026981
• Gene ID - Rat: ENSRNOG00000005871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL1RN pAb (ATL-HPA001482 w/enhanced validation) – 1 Found

Schneider, Lisa; Liu, Junnan; Zhang, Cheng; Azoitei, Anca; Meessen, Sabine; Zheng, Xi; Cremer, Catharina; Gorzelanny, Christian; Kempe-Gonzales, Sybille; Brunner, Cornelia; Wezel, Felix; Bolenz, Christian; Gunes, Cagatay; John, Axel. The Role of Interleukin-1-Receptor-Antagonist in Bladder Cancer Cell Migration and Invasion. International Journal Of Molecular Sciences. 2021;22(11)