Anti IL1R1 pAb (ATL-HPA029560)

Atlas Antibodies

Catalog No.: ATL-HPA029560-25

Protein Description: interleukin 1 receptor, type I
Gene Name: IL1R1
Alternative Gene Name: CD121A, D2S1473, IL1R, IL1RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026072: 84%, ENSRNOG00000014504: 80%
Entrez Gene ID: 3554
Uniprot ID: P14778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF
• Gene Sequence: VLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLF
• Gene ID - Mouse: ENSMUSG00000026072
• Gene ID - Rat: ENSRNOG00000014504
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL1R1 pAb (ATL-HPA029560) – 1 Found

McClellan, Alyce; Evans, Richard; Sze, Cheryl; Kan, Shohei; Paterson, Yasmin; Guest, Deborah. A novel mechanism for the protection of embryonic stem cell derived tenocytes from inflammatory cytokine interleukin 1 beta. Scientific Reports. 2019;9(1):2755.