Anti IL1R1 pAb (ATL-HPA005823)

Atlas Antibodies

Catalog No.: ATL-HPA005823-25

Protein Description: interleukin 1 receptor, type I
Gene Name: IL1R1
Alternative Gene Name: CD121A, D2S1473, IL1R, IL1RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026072: 64%, ENSRNOG00000014504: 64%
Entrez Gene ID: 3554
Uniprot ID: P14778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
• Gene Sequence: VAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
• Gene ID - Mouse: ENSMUSG00000026072
• Gene ID - Rat: ENSRNOG00000014504
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL1R1 pAb (ATL-HPA005823) – 2 Found

Yang, Li; Mizuochi, Tatsuki; Shivakumar, Pranavkumar; Mourya, Reena; Luo, Zhenhua; Gutta, Sridevi; Bezerra, Jorge A. Regulation of epithelial injury and bile duct obstruction by NLRP3, IL-1R1 in experimental biliary atresia. Journal Of Hepatology. 2018;69(5):1136-1144. 

Bardin, Pauline; Foussignière, Tobias; Rousselet, Nathalie; Rebeyrol, Carine; Porter, Joanna C; Corvol, Harriet; Tabary, Olivier. miR-636: A Newly-Identified Actor for the Regulation of Pulmonary Inflammation in Cystic Fibrosis. Frontiers In Immunology. 10( 31803183):2643.