Anti IGFBP6 pAb (ATL-HPA008005)

Atlas Antibodies

Catalog No.: ATL-HPA008005-25

Protein Description: insulin-like growth factor binding protein 6
Gene Name: IGFBP6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023046: 71%, ENSRNOG00000010977: 68%
Entrez Gene ID: 3489
Uniprot ID: P24592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWC
• Gene Sequence: PGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWC
• Gene ID - Mouse: ENSMUSG00000023046
• Gene ID - Rat: ENSRNOG00000010977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGFBP6 pAb (ATL-HPA008005) – 1 Found

Brockway, Heather M; Kallapur, Suhas G; Buhimschi, Irina A; Buhimschi, Catalin S; Ackerman, William E; Muglia, Louis J; Jones, Helen N. Unique transcriptomic landscapes identified in idiopathic spontaneous and infection related preterm births compared to normal term births. Plos One. 14(11):e0225062.