Anti IGF2BP2 pAb (ATL-HPA035145)

Atlas Antibodies

Catalog No.:
ATL-HPA035145-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: insulin-like growth factor 2 mRNA binding protein 2
Gene Name: IGF2BP2
Alternative Gene Name: IMP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033581: 57%, ENSRNOG00000025946: 58%
Entrez Gene ID: 10644
Uniprot ID: Q9Y6M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Gene Sequence ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Gene ID - Mouse ENSMUSG00000033581
Gene ID - Rat ENSRNOG00000025946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti IGF2BP2 pAb (ATL-HPA035145)
Datasheet Anti IGF2BP2 pAb (ATL-HPA035145) Datasheet (External Link)
Vendor Page Anti IGF2BP2 pAb (ATL-HPA035145) at Atlas Antibodies

Documents & Links for Anti IGF2BP2 pAb (ATL-HPA035145)
Datasheet Anti IGF2BP2 pAb (ATL-HPA035145) Datasheet (External Link)
Vendor Page Anti IGF2BP2 pAb (ATL-HPA035145)